DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and Rnf150

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_017168354.1 Gene:Rnf150 / 330812 MGIID:2443860 Length:450 Species:Mus musculus


Alignment Length:166 Identity:43/166 - (25%)
Similarity:77/166 - (46%) Gaps:42/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1019 NQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCD 1083
            ||:.:::|  .:.:.|.      .|||:|..:.:::.::..:  .|.:.|..: |..:|.||:..
Mouse   243 NQYTIATG--QDWQLYR------RRLGDAAKKAISKLQVRTI--RKGDKETES-DFDNCAVCIEG 296

  Fly  1084 FELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNA---------SDYFDG--VDQQQQSQAT 1137
            ::...::|:|||.|.||..|||.||..:||||:|:.|.         :|..|.  :|        
Mouse   297 YKPNDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPID-------- 353

  Fly  1138 AGAAAALSGTSGG--SAGVAGTSEA----SAATANP 1167
                  ..|:.||  :..:.|.|:.    |:.|.:|
Mouse   354 ------FEGSLGGPPTNQITGASDTTVNESSVTLDP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 19/41 (46%)
Rnf150XP_017168354.1 PA_GRAIL_like 45..192 CDD:239037
RING-H2_GRAIL 289..336 CDD:319582 21/46 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.