DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and Rnf165

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001157977.1 Gene:Rnf165 / 307251 RGDID:1560744 Length:348 Species:Rattus norvegicus


Alignment Length:410 Identity:107/410 - (26%)
Similarity:150/410 - (36%) Gaps:130/410 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   755 PILQQVQ---APPQPPSHQQAVG---YPQAPPQPASLMVDLNLNQVPVNLQLRPSEPFWASFCTY 813
            |:...|:   ||.|...|..|..   :...||||.               ||.|..|.     .:
  Rat    12 PVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQ---------------QLAPDFPL-----AH 56

  Fly   814 PIPAQ----ARLAPCHLH-GVYTQ---PFPAAPPPGLAAPPL--QQQHQPLIQAQQMISQATLTA 868
            |:.:|    |.:||.|.| |...|   |.|......:..|..  |..||..:..||::       
  Rat    57 PVQSQPGLSAHMAPAHQHSGTLHQSLTPLPTLQFQDVTGPSFLPQALHQQYLLQQQLL------- 114

  Fly   869 QQQQRDVVAIATANLGPIEAPGAHGHPH-------AHPH-AHP---HAHQLPPGIHITPLSGAAA 922
            :.|.|.:|:                ||.       .||| .||   ..|||.     ||.....|
  Rat   115 EAQHRRLVS----------------HPRRSQDRVSVHPHRLHPSFDFGHQLQ-----TPQPRYLA 158

  Fly   923 AAATHHLHSTAAAAAAVAAGAQITTAQ-QILFSSDRRTFPPHRRIPRFWTANHGHRHVLPPQSLA 986
            ......|...||:         ::.|| |:      |..|.|            ::|.|....: 
  Rat   159 EGTDWDLSVDAAS---------LSPAQFQV------RPIPQH------------YQHYLATPRM- 195

  Fly   987 AHQAPVQIQATSGIIN-----PGFLLNFLAMFPLSPYNQHDLSSGDTNETENYEALLSLAERLGE 1046
             |..|....:|..:::     |...|:|||:..|:|      |...:...|:||.||.|.:|||.
  Rat   196 -HHFPRNSSSTQMVVHEIRNYPYPQLHFLALQGLNP------SRHTSAVRESYEELLQLEDRLGN 253

  Fly  1047 AKPRGLTRNEIDQLP---SY-KFNPEVHNGDQ---------SSCVVCMCDFELRQLLRVLPCSHE 1098
            . .||..:|.|::..   .| |..|:...|.:         ..|.:|:...|..:.:|.|||.|.
  Rat   254 V-TRGAVQNTIERFTFPHKYKKRRPQDSKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHL 317

  Fly  1099 FHAKCVDKWLRSNRTCPICR 1118
            ||..|||:||..::.|||||
  Rat   318 FHQLCVDQWLAMSKKCPICR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 18/41 (44%)
Rnf165NP_001157977.1 AreA_N <30..84 CDD:284898 18/73 (25%)
zf-RING_2 296..337 CDD:290367 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.