DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and Znrf4

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001020049.1 Gene:Znrf4 / 301127 RGDID:1563631 Length:327 Species:Rattus norvegicus


Alignment Length:444 Identity:84/444 - (18%)
Similarity:126/444 - (28%) Gaps:181/444 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   778 APPQPASLMVDLNLNQVPVNLQLRPSEPFWASFCTYPIPAQARLAPCHLHGVYTQPFPAAPPPGL 842
            ||....:|.:.|:|:  |.:.|:..|.   ..|...|......:.|....|......||.....:
  Rat    10 APLALVALWLVLSLS--PTDAQVNLSS---GDFLDLPALLGVPVDPKRARGYLLVARPADACLAI 69

  Fly   843 AAPPLQQQH-QPLIQAQQMISQATLTAQQQQRDVVAIATANLGPIEAPG---------------- 890
            ..|.|..:. .||:..|.:......|.::.:|   |.|||.....||||                
  Rat    70 EGPGLDNRSLDPLVLVQPLGCSWEHTGRRARR---ARATAASMGSEAPGQLRVFEDLEVTVRCDQ 131

  Fly   891 ------AHGHPHAHPHAHPHAHQLPPGIHITPLSGAAAAAATHHLHSTAAAAAAVAAGAQITTAQ 949
                  .||.|...|..||                              ..||:.|....:..|.
  Rat   132 SARVLLPHGEPCPEPECHP------------------------------VVAASWALARALALAA 166

  Fly   950 QILFSSDRRTFPPHRRIPRFWTANHGHRHVLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFP 1014
            ..||.. |:.:|        |....|.|                                     
  Rat   167 STLFVL-RQLWP--------WVRGWGSR------------------------------------- 185

  Fly  1015 LSPYNQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVV 1079
                       |...:|:..:          :|:.|..||  :..|                |.:
  Rat   186 -----------GTAVKTQTCQ----------KAQVRTFTR--LSDL----------------CAI 211

  Fly  1080 CMCDFELRQLLRVLPCSHEFHAKCVDKWL--RSNRTCPICRGNASDYFDGVDQQQQSQATAGAAA 1142
            |:.|:|..:.|::|||:|.:|.:|:|.|.  .:.|:||:|:.:.:...||    ....:..|..|
  Rat   212 CLDDYEEGERLKILPCAHAYHCRCIDPWFSRAARRSCPLCKQSVASTHDG----STDGSIGGDEA 272

  Fly  1143 ALSG-----------------------------TSGGSAGVAGTSEASAATANP 1167
            .|.|                             .|..|.|:|.....|.||..|
  Rat   273 PLPGHRPPIWAIQARLRSRRLELLARTVPCRRCNSTTSLGMAENVAPSEATPEP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 16/43 (37%)
Znrf4NP_001020049.1 Peptidases_S8_S53 31..>93 CDD:299169 12/64 (19%)
zf-RING_2 207..252 CDD:290367 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.