DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and Rnf11

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_038904.1 Gene:Rnf11 / 29864 MGIID:1352759 Length:154 Species:Mus musculus


Alignment Length:116 Identity:36/116 - (31%)
Similarity:50/116 - (43%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1014 PLSPYNQ-------HDLSSGD---TNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPE 1068
            |..||.:       |...|..   |..||  |..:.:|:|:|          .|..||...::|.
Mouse    36 PPPPYQEQVPVPIYHPTPSQTRLATQLTE--EEQIRIAQRIG----------LIQHLPKGVYDPG 88

  Fly  1069 VHNGDQS--SCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPIC 1117
            ....::.  .||:||.||.....:|.|||.|.:|..|:|.||..:.|||.|
Mouse    89 RDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 20/42 (48%)
Rnf11NP_038904.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 4/15 (27%)
PPxY motif 37..40 0/2 (0%)
RING-H2_RNF11 98..140 CDD:319382 20/42 (48%)
RING-H2 finger (C3H2C3-type) 99..139 CDD:319382 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.