DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and RNF149

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_005263977.1 Gene:RNF149 / 284996 HGNCID:23137 Length:428 Species:Homo sapiens


Alignment Length:228 Identity:60/228 - (26%)
Similarity:98/228 - (42%) Gaps:60/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 IPRFWTANHGHRHVLPPQSLAAHQAPVQIQ---ATSGIINPGFLLNFLAMFPLSPYNQHDLSSGD 1027
            ||...|...|.|||   |...:.|:.|.:.   .|..||:..:|:.:        |.|..|.:| 
Human   179 IPVTMTIGVGTRHV---QEFISGQSVVFVAIAFITMMIISLAWLIFY--------YIQRFLYTG- 231

  Fly  1028 TNETENYEALLSLAERLGEAKPRGLTRNEIDQ--LPSYKFNPEVHNGDQSSCVVCMCDFELRQLL 1090
                          .::|....|..|:..|.|  |.:.|...:..:.|..:|.||:.:|:::.::
Human   232 --------------SQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDII 282

  Fly  1091 RVLPCSHEFHAKCVDKWLRSNRTCPICR----------GNASDYFDGVDQQQQSQATAG--AAAA 1143
            |:|||.|.||..|:|.||..:||||:|:          |...|    |.:....::..|  .||.
Human   283 RILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGD----VQEMPAPESPPGRDPAAN 343

  Fly  1144 LSGTSGGSAGVA-----GTSEASAATANPQQSQ 1171
            ||        :|     |:.::|..:|:|.:|:
Human   344 LS--------LALPDDDGSDDSSPPSASPAESE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 19/41 (46%)
RNF149XP_005263977.1 PA_GRAIL_like 43..185 CDD:239037 2/5 (40%)
UPF0233 <204..>235 CDD:299753 8/53 (15%)
zf-RING_2 267..310 CDD:290367 19/42 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.