DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and RNF115

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_055270.1 Gene:RNF115 / 27246 HGNCID:18154 Length:304 Species:Homo sapiens


Alignment Length:201 Identity:57/201 - (28%)
Similarity:82/201 - (40%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   963 HRRIPRFWTANHGHRHVLPPQ-------SLAAHQAPVQIQATSGIIN---PGFLLNFLAMFPLSP 1017
            |:....||.|.       ||:       .......|.:..|..||:.   .||..|  :..|.||
Human   107 HQTHTDFWGAR-------PPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFAN--SAIPGSP 162

  Fly  1018 Y----------NQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPE-VHN 1071
            :          |..|.:.|.|........||...|..|   |....:.:|..||:.....| |..
Human   163 HPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTG---PPPADKEKITSLPTVTVTQEQVDM 224

  Fly  1072 GDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDGVDQQQQSQA 1136
            |  ..|.||..|:.:.:.:|.|||:|.||:.|:..||..:.|||:||.:    .:|.|..:|||:
Human   225 G--LECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKS----LNGEDSTRQSQS 283

  Fly  1137 TAGAAA 1142
            |..:|:
Human   284 TEASAS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 17/41 (41%)
RNF115NP_055270.1 zinc_ribbon_9 19..49 CDD:316857
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..138 7/37 (19%)
RING-H2_RNF115 226..272 CDD:319714 19/49 (39%)
RING-H2 finger (C3H2C3-type) 228..268 CDD:319714 17/39 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.