Sequence 1: | NP_731367.2 | Gene: | mura / 41145 | FlyBaseID: | FBgn0037705 | Length: | 1173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055270.1 | Gene: | RNF115 / 27246 | HGNCID: | 18154 | Length: | 304 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 57/201 - (28%) |
---|---|---|---|
Similarity: | 82/201 - (40%) | Gaps: | 39/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 963 HRRIPRFWTANHGHRHVLPPQ-------SLAAHQAPVQIQATSGIIN---PGFLLNFLAMFPLSP 1017
Fly 1018 Y----------NQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPE-VHN 1071
Fly 1072 GDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDGVDQQQQSQA 1136
Fly 1137 TAGAAA 1142 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mura | NP_731367.2 | zf-RING_2 | 1076..1118 | CDD:290367 | 17/41 (41%) |
RNF115 | NP_055270.1 | zinc_ribbon_9 | 19..49 | CDD:316857 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 95..138 | 7/37 (19%) | |||
RING-H2_RNF115 | 226..272 | CDD:319714 | 19/49 (39%) | ||
RING-H2 finger (C3H2C3-type) | 228..268 | CDD:319714 | 17/39 (44%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 272..304 | 7/18 (39%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |