DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and RNF167

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens


Alignment Length:140 Identity:39/140 - (27%)
Similarity:65/140 - (46%) Gaps:42/140 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 LTRNEIDQLPSYKFNPEVHN--------------------GDQ-SSCVVCMCDFELRQLLRVLPC 1095
            ||:.::.|:|::.:...:::                    ||| ..|.:|:.::|....||||||
Human   208 LTKEQLKQIPTHDYQKALNSSMFCPDLILPTCLISSTGFVGDQYDVCAICLDEYEDGDKLRVLPC 272

  Fly  1096 SHEFHAKCVDKWL-RSNRTCPIC-----RGNASDYFDGVDQQQQSQATAGAAAALSGTSGGSAGV 1154
            :|.:|::|||.|| ::.:|||||     ||...:     ||::::|          |...|..|.
Human   273 AHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDE-----DQEEETQ----------GQEEGDEGE 322

  Fly  1155 AGTSEASAAT 1164
            .....||..|
Human   323 PRDHPASERT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 21/47 (45%)
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038
RING-H2_RNF167 252..297 CDD:319711 21/44 (48%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 19/40 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.