powered by:
Protein Alignment mura and Rnf103
DIOPT Version :9
Sequence 1: | NP_731367.2 |
Gene: | mura / 41145 |
FlyBaseID: | FBgn0037705 |
Length: | 1173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_033569.2 |
Gene: | Rnf103 / 22644 |
MGIID: | 109483 |
Length: | 683 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 25/66 - (37%) |
Similarity: | 31/66 - (46%) |
Gaps: | 17/66 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1070 HNGDQ----------------SSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNR-TCPIC 1117
||.|: :.||||:.:||...||..|||.|.||..|:..||...| .||:|
Mouse 596 HNTDEDMEPDWLTWPAGTLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVC 660
Fly 1118 R 1118
|
Mouse 661 R 661
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1487241at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.