DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and Znrf4

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_035613.2 Gene:Znrf4 / 20834 MGIID:1341258 Length:327 Species:Mus musculus


Alignment Length:359 Identity:72/359 - (20%)
Similarity:108/359 - (30%) Gaps:151/359 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   806 FWASFCTYPIPAQARLAPCH------LHGVYTQPFPAAPPPGLAAP---------PLQQQH--QP 853
            ||......|..||..|:...      |.||...|..|.....:|.|         |....|  .|
Mouse    17 FWLVLSLSPTDAQVNLSSVDFLDLPALLGVPVDPKRARGYLLVARPADACHAIEGPWPDNHSLDP 81

  Fly   854 LIQAQQMISQATLTAQQQQRDVVAIATANLGPIEAPGAHGH------------------PHAHPH 900
            |:..:.:......|.::.||  .....|::|| ||||....                  |||.|.
Mouse    82 LVLVRPLGCSWEQTGRRAQR--AGATAASVGP-EAPGQLREFEDLEVTVRCDQPARVLLPHAEPC 143

  Fly   901 AHPHAHQLPPGIHITPLSGAAAAAATHHLHSTAAAAAAVAAGAQITTAQQILFSSDRRTFPPHRR 965
            ..|..|         |:..|:.|         .|.|.|:||......         |:.:|    
Mouse   144 PDPECH---------PVVVASWA---------LARALALAASTLFVL---------RQLWP---- 177

  Fly   966 IPRFWTANHGHRHVLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFPLSPYNQHDLSSGDTNE 1030
                |....|.|                                                |...:
Mouse   178 ----WVRGLGSR------------------------------------------------GTAVK 190

  Fly  1031 TENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPC 1095
            |:..:          :|:.|..||  :..|                |.:|:.|:|..:.|::|||
Mouse   191 TQTCQ----------KAQVRTFTR--LSDL----------------CAICLDDYEEGERLKILPC 227

  Fly  1096 SHEFHAKCVDKWL--RSNRTCPICRGNASDYFDG 1127
            :|.:|.:|:|.|.  .:.|:||:|:.:.:...||
Mouse   228 AHAYHCRCIDPWFSRAAQRSCPLCKQSVASTHDG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 16/43 (37%)
Znrf4NP_035613.2 PA_C_RZF_like 19..156 CDD:239038 33/148 (22%)
zf-RING_2 207..252 CDD:290367 17/60 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..279 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.