DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and RNF215

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001017981.1 Gene:RNF215 / 200312 HGNCID:33434 Length:377 Species:Homo sapiens


Alignment Length:435 Identity:101/435 - (23%)
Similarity:153/435 - (35%) Gaps:134/435 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   753 VGPILQ-QVQAPPQPPSHQQAVGYPQAPPQPASLMVDLNLNQVPVNLQLRPSEPFW--------A 808
            :||..: .:::||.||           ||.|:.|::            |.|..|.|        |
Human     1 MGPAARPALRSPPPPP-----------PPPPSPLLL------------LLPLLPLWLGLAGPGAA 42

  Fly   809 SFCTYP-----------------IPAQARLAPCHLHGVYTQPFPAAPPPGLAAPPLQQQHQPLIQ 856
            :..:.|                 :|.|..|.   |.||..         |..|.|     .||:.
Human    43 ADGSEPAAGAGRGGARAVRVDVRLPRQDALV---LEGVRI---------GSEADP-----APLLG 90

  Fly   857 AQQMISQATLTAQQQQRDVVAIATANLGPIEAPGAH-GHPHAHPHAHPHA--HQLPPGIHITPLS 918
            .:.::.. .:.|:|:......||.|.:|..:|...| .:..:.|.|:|.|  .|:...:.:    
Human    91 GRLLLMD-IVDAEQEAPVEGWIAVAYVGKEQAAQFHQENKGSGPQAYPKALVQQMRRALFL---- 150

  Fly   919 GAAA---AAATHH-----------------LHSTA-------AAAAAVAAGAQITTAQQILFSSD 956
            ||:|   ....|:                 ||.::       |......|.|:||:.:.:..:.:
Human   151 GASALLLLILNHNVVRELDISQLLLRPVIVLHYSSNVTKLLDALLQRTQATAEITSGESLSANIE 215

  Fly   957 RRTFPPHRRIPRFWT----ANHGHRH----VLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMF 1013
            .:.        ..||    :..|:..    |....|.|..|.|:| |..:.|:    |:..|...
Human   216 WKL--------TLWTTCGLSKDGYGGWQDLVCLGGSRAQEQKPLQ-QLWNAIL----LVAMLLCT 267

  Fly  1014 PLSPYNQHDLSSGDTNETENYEALLS--LAERLGEAKPRGLTRNEIDQ-LPSYKFNPEVHNGDQS 1075
            .|....|...|.....|......|..  :..||...|.|....:...| ||         :....
Human   268 GLVVQAQRQASRQSQRELGGQVDLFKRRVVRRLASLKTRRCRLSRAAQGLP---------DPGAE 323

  Fly  1076 SCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN 1120
            :|.||:..|..:|.||||||.||||..|||.||...:|||:|:.|
Human   324 TCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQTCPLCKFN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 23/41 (56%)
RNF215NP_001017981.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 9/31 (29%)
zf-RING_2 323..366 CDD:290367 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.