powered by:
Protein Alignment mura and plr-1
DIOPT Version :9
Sequence 1: | NP_731367.2 |
Gene: | mura / 41145 |
FlyBaseID: | FBgn0037705 |
Length: | 1173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499473.2 |
Gene: | plr-1 / 176575 |
WormBaseID: | WBGene00023404 |
Length: | 487 |
Species: | Caenorhabditis elegans |
Alignment Length: | 76 |
Identity: | 31/76 - (40%) |
Similarity: | 42/76 - (55%) |
Gaps: | 11/76 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1074 QSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN-ASDYFDGVDQQQQSQAT 1137
|..||:|:.::|....||||.|.||||.||||.||.|.|.||:|:.: ...::..||..::
Worm 314 QERCVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLCQFDVVYKHYPKVDSPEK---- 374
Fly 1138 AGAAAALSGTS 1148
|||.|
Worm 375 ------LSGRS 379
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1487241at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R768 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.040 |
|
Return to query results.
Submit another query.