DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and plr-1

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_499473.2 Gene:plr-1 / 176575 WormBaseID:WBGene00023404 Length:487 Species:Caenorhabditis elegans


Alignment Length:76 Identity:31/76 - (40%)
Similarity:42/76 - (55%) Gaps:11/76 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1074 QSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN-ASDYFDGVDQQQQSQAT 1137
            |..||:|:.::|....||||.|.||||.||||.||.|.|.||:|:.: ...::..||..::    
 Worm   314 QERCVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLCQFDVVYKHYPKVDSPEK---- 374

  Fly  1138 AGAAAALSGTS 1148
                  |||.|
 Worm   375 ------LSGRS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 23/41 (56%)
plr-1NP_499473.2 zf-rbx1 305..358 CDD:289448 24/43 (56%)
zf-RING_2 317..357 CDD:290367 23/39 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R768
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.