DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf215

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_005165127.1 Gene:rnf215 / 101882431 ZFINID:ZDB-GENE-060526-65 Length:351 Species:Danio rerio


Alignment Length:115 Identity:38/115 - (33%)
Similarity:54/115 - (46%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1023 LSSG----------DTNETENYEALL--SLAERLGEAKPRGLTRNEIDQLPSYKFNP-EVHNGDQ 1074
            ||:|          |....::.|:.|  .:.:||...|.|...:      |..:.:| :....:.
Zfish   241 LSTGVIVQARWQYQDNQFNDDLESNLKQDILKRLSALKTRTYRQ------PKVRCDPTQTQTMET 299

  Fly  1075 SSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICR----GN 1120
            .||.||:..:...|.||||||.||||..|||.||...:|||:|:    ||
Zfish   300 ESCAVCLEQYNNNQCLRVLPCLHEFHRDCVDPWLLLQQTCPLCKRSVLGN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 23/41 (56%)
rnf215XP_005165127.1 zf-RING_2 300..343 CDD:290367 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.