DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf43

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_002935238.2 Gene:rnf43 / 100491274 XenbaseID:XB-GENE-952685 Length:689 Species:Xenopus tropicalis


Alignment Length:318 Identity:76/318 - (23%)
Similarity:112/318 - (35%) Gaps:93/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   912 IHITPLSGAAAAAATHHLHSTAAAAAAVAAGAQITTAQQILF----------SSDRRTFPPHRRI 966
            |.:|||....:....   ..........|..|:|:.|:..|.          |.|.:|.|....|
 Frog    39 IRVTPLQAEESGGVG---QGNLTLEGLFARVAEISPAEGRLLQFHPLSLCNTSEDDQTKPGFISI 100

  Fly   967 PRFWTANHGHRHVLPPQSLA----------AHQ----------APVQIQATSGIINPGFLL---- 1007
            .:..|.:   |...|..|||          ||.          |..|:|..:||..|..|:    
 Frog   101 VKLETPD---RDTQPCLSLANKARLAGERGAHAVLFDITNDRGALQQLQQPAGINQPVVLIWGPD 162

  Fly  1008 ----------NFLAMFPLSPYNQ-----HDL-----SSGDTNETENYEALLSLAERLGEAKP--- 1049
                      |..|:..:....|     ||:     .:|    |..:..|.::|..|....|   
 Frog   163 AEKLMDVVNKNKEALVKIEVQEQPKWLHHDIWILLTVAG----TVMFFVLYAVARLLCRQPPPQD 223

  Fly  1050 --RGLTRNEIDQLPSYKFNPEVHNGDQSS---------------CVVCMCDFELRQLLRVLPCSH 1097
              :..|...|.:|.:.::...:....::|               |.:|:.:|...|.||:|||.|
 Frog   224 SIQQQTLLAISRLGTRRYQQRMLKDQRASGGWVETASTSSSVPVCAICLEEFTDGQELRILPCCH 288

  Fly  1098 EFHAKCVDKWLRSNRTCPICRGNASDYFDGVDQQQQSQATAGAAAA---LSGTSGGSA 1152
            |:|..|||.|||.|.|||:|      .:|.:|.....:..|..|.:   |.|...|||
 Frog   289 EYHLGCVDPWLRQNHTCPLC------MYDILDSGTPPRPLAHRAPSQTQLWGRYPGSA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 23/56 (41%)
rnf43XP_002935238.2 ZNRF_3_ecto 80..182 CDD:375639 22/104 (21%)
HRD1 <244..366 CDD:227568 33/103 (32%)
RING-H2_RNF43_like 267..311 CDD:319580 23/49 (47%)
RING-H2 finger (C3H2C3-type) 268..308 CDD:319580 22/39 (56%)
DUF4573 523..643 CDD:373595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.