DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf11b

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001121880.1 Gene:rnf11b / 100150568 ZFINID:ZDB-GENE-050913-69 Length:154 Species:Danio rerio


Alignment Length:92 Identity:31/92 - (33%)
Similarity:44/92 - (47%) Gaps:14/92 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1028 TNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQS--SCVVCMCDFELRQLL 1090
            |..||  |..:.:|:|:|          .|..||...::|.....::.  .||:||.||.....:
Zfish    60 TQLTE--EEQVRIAQRIG----------LIQHLPKGVYDPGSDGTEKKIRECVICMMDFVYGDPI 112

  Fly  1091 RVLPCSHEFHAKCVDKWLRSNRTCPIC 1117
            |.|||.|.:|..|:|.||..:.|||.|
Zfish   113 RFLPCMHIYHLDCIDDWLMRSFTCPSC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 20/42 (48%)
rnf11bNP_001121880.1 RING-H2_RNF11 98..140 CDD:319382 20/42 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.