DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf130

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001107712.1 Gene:rnf130 / 100124963 XenbaseID:XB-GENE-949564 Length:419 Species:Xenopus tropicalis


Alignment Length:173 Identity:45/173 - (26%)
Similarity:73/173 - (42%) Gaps:50/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1024 SSGDTNETENYEALLSLAERLGEAKPRGL----TRNEIDQLPSYKFNPEVHNGDQSS------CV 1078
            |:.|.|:           .|||:|..:.:    ||.             |..||:.:      |.
 Frog   225 SARDRNQ-----------RRLGDAAKKAIGKLTTRT-------------VKKGDKETDPDFDHCA 265

  Fly  1079 VCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICR-------GNASDY-------FDGVD 1129
            ||:..::...::|||||.|.||..|||.||..:.|||:|:       |.|::.       || ::
 Frog   266 VCIESYKQNDIVRVLPCKHVFHKVCVDPWLSEHCTCPMCKLNILKALGIAANVPCTDNVAFD-ME 329

  Fly  1130 QQQQSQATAGAAAALSGTSGGSAGVAGTSEASAATANPQQSQA 1172
            :..:||..:..:|....|..||..:. :..:|..:..|...:|
 Frog   330 RLTRSQPPSRRSAPNDPTEEGSLSLE-SLRSSRISQGPHDVEA 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 19/47 (40%)
rnf130NP_001107712.1 PA_GRAIL_like 41..179 CDD:239037
HRD1 <197..344 CDD:227568 39/143 (27%)
RING_Ubox 262..310 CDD:388418 20/47 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.