DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment by and PVRAP

DIOPT Version :9

Sequence 1:NP_001163569.1 Gene:by / 41144 FlyBaseID:FBgn0000244 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_729124.1 Gene:PVRAP / 38677 FlyBaseID:FBgn0052406 Length:474 Species:Drosophila melanogaster


Alignment Length:516 Identity:116/516 - (22%)
Similarity:181/516 - (35%) Gaps:153/516 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GIAKTSTPLRKTPTPTRVDSFLDFDFGPTNTNVNSNSSSNNGGTGDMIKPPTRLTSPLLVRKTLG 142
            |.|.||..:......|...|    :..||..|.||||:||:...               :.:.|.
  Fly    36 GTAATSVAMSNRNGSTSSSS----NSSPTADNSNSNSNSNSNAN---------------INRNLN 81

  Fly   143 NAVSPTSSTNTNTIANTYHYTSSSATPTPVRDNFEQLLRERREKVYNEY-----RNLDRESSGER 202
            .  :|.|::|||  :|:|                           :|.:     .||....:|..
  Fly    82 Q--NPNSNSNTN--SNSY---------------------------FNRFDNRIAANLAAVLTGAG 115

  Fly   203 ARVAPAPPQRQYYPSDGYGIGLKNDS-----NGTLYRK-------SPSSNGKSTKYNYDFEFNLN 255
            ||.      |....|:.:..|:.|.:     ..|:.||       ||:|.|:..........|||
  Fly   116 ARF------RSSSCSNRHPAGVANPAVLRSPLATISRKTSLATPPSPASLGRRRPLQLFTHANLN 174

  Fly   256 L-DDVRPEPTPYTTRNIHFEDL----RLDQDVPDGVVNRRTM------ERNYHTINSLETTHKRQ 309
            . |:.:...||.:..:....:|    ||....|  :|.|.||      |.:...:..:.......
  Fly   175 CNDNEKVAQTPSSDEDNSPTELNSCKRLADKPP--LVKRLTMGLLRQNEESRPLVGDMTPLSAPL 237

  Fly   310 QLEPLEQLGAVYGQNHMEETLTRTRRDLSASTSTSKSTSPLPAIGVPAIAPASPIYATSTKRVSN 374
            .::|      ||...::.|.   :..|.....|..:|.:.:|.:                   .|
  Fly   238 DIQP------VYSNGYINED---SYIDSKFGDSCRQSLTAIPML-------------------DN 274

  Fly   375 PNTNGQQQM---------TPSPTSRPETPAFPVTPRTPFGASSSSSASLAPTTQLPPESIYQTGP 430
            .|.|...:.         |.|..|.|:  .|....|...||.....:|||       .:....|.
  Fly   275 VNLNDNNEFNLKKRYLRETSSANSSPK--IFANRLRMNQGAVGQRCSSLA-------NAFGNVGS 330

  Fly   431 RRGVPPALQPLEVSADSVQFARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLV 495
            ..      :.||:          ....||:..::|:.|:.:|.|..||.||||.|::....|.|.
  Fly   331 DE------EDLEL----------KDACWYQAGISRDIAVEVLQSKSPGAFLVRKSSSKPGCYALT 379

  Fly   496 VRVSQPPPGSQELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLP 556
            :||.. |||.:  :.:::|..:..|..:||...|  |:||.||:..||:....||..|.:|
  Fly   380 LRVPS-PPGPK--IANYIILRSPRGYKIKGFRKE--FSSLKALITHHSVMPELLPVPLAMP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
byNP_001163569.1 SH2_Tensin_like 454..559 CDD:198181 36/103 (35%)
PTB_tensin 578..711 CDD:269924
PVRAPNP_729124.1 SH2 342..435 CDD:301589 35/97 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45734
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.