DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and RAS2

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_014301.1 Gene:RAS2 / 855625 SGDID:S000005042 Length:322 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:111/178 - (62%)
Similarity:135/178 - (75%) Gaps:8/178 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67
            ||||||||.||||||||||||.|:|||||||||||||||||||||.|..:|||||||||||||||
Yeast    10 EYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVIDDEVSILDILDTAGQEEYSAM 74

  Fly    68 RDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLAS-WNVNNEQAR 131
            |:||||.|||||||:::.|..|.:::.||.:||.||||.:.||:|:||||.||.: ..|:.:...
Yeast    75 REQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVVVGNKSDLENEKQVSYQDGL 139

  Fly   132 EVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNK 179
            .:|||...|::|||||..:.|::|||||.|.:|.:       |.|.||
Yeast   140 NMAKQMNAPFLETSAKQAINVEEAFYTLARLVRDE-------GGKYNK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 106/161 (66%)
RAS2NP_014301.1 small_GTPase 9..172 CDD:197466 106/161 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I518
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I775
Isobase 1 0.950 - 0 Normalized mean entropy S22
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.700

Return to query results.
Submit another query.