DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and RAS1

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_014744.1 Gene:RAS1 / 854268 SGDID:S000005627 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:112/182 - (61%)
Similarity:142/182 - (78%) Gaps:8/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67
            |||:||||.|||||||||||.||::||||||||||||||||||||.:..:|||||||||||||||
Yeast    10 EYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSILDILDTAGQEEYSAM 74

  Fly    68 RDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLAS-WNVNNEQAR 131
            |:||||||||||||::|.|..||:::.:|.:||:||||::.:|:|:||||.||.: ..|:.|...
Yeast    75 REQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIPVVVVGNKLDLENERQVSYEDGL 139

  Fly   132 EVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRR 183
            .:|||...|::|||||..:.||:|||:|:|.:|.|       |.|.|..||:
Yeast   140 RLAKQLNAPFLETSAKQAINVDEAFYSLIRLVRDD-------GGKYNSMNRQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 105/161 (65%)
RAS1NP_014744.1 small_GTPase 9..172 CDD:197466 105/161 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I518
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I775
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.750

Return to query results.
Submit another query.