DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and RHB1

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_009956.2 Gene:RHB1 / 850392 SGDID:S000000622 Length:209 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:51/188 - (27%)
Similarity:96/188 - (51%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRD 69
            |:.::||..|||:.||::.:::.||:.|.||||:.:.:.:......|.|:|||||||:|.|.:..
Yeast    18 KIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNI 82

  Fly    70 QYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWN------VNNE 128
            :.:....|.:|.:::.:..||:.|....:::......:.:|::|||.|.||....      |...
Yeast    83 KSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTKADLGRSTKGVKRCVTKA 147

  Fly   129 QAREVAKQYG-------IPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNK 179
            :..::|...|       ..:||.||:....|::.|..|::::.:.:...|......||
Yeast   148 EGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFMLLLKQMERVEGTLGLDAENNNK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 48/171 (28%)
RHB1NP_009956.2 RheB 16..209 CDD:206709 51/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.