DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and rit1

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001122253.1 Gene:rit1 / 793942 ZFINID:ZDB-GENE-070912-329 Length:211 Species:Danio rerio


Alignment Length:193 Identity:85/193 - (44%)
Similarity:128/193 - (66%) Gaps:12/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67
            |||||::|.|||||||:.:|.|.:.|.:::||||||:|:.|:.||.|...|||||||||.|::||
Zfish    13 EYKLVMLGEGGVGKSAIIMQFISHRFPEDHDPTIEDAYKTQIRIDDEPANLDILDTAGQAEFTAM 77

  Fly    68 RDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASW-NVNNEQAR 131
            ||||||.||||::.:::...:||::...:::.|.||:...:.|:||||||.||... .|:.|:.:
Zfish    78 RDQYMRAGEGFIISYSITDRRSFQEARHFKQLIYRVRRTVDTPVVLVGNKSDLVHLRQVSVEEGK 142

  Fly   132 EVAKQYGIPYIETSAKTRMGVDDAFYTLVREIR-------KDKDNKGRRGR----KMNKPNRR 183
            ::|:::..|:.||||..|..:|:.|..|||:||       :|.:.|.||..    ::..|..|
Zfish   143 QLAREFQCPFFETSAAFRYYIDEVFAALVRQIRQHEAEMVRDSERKTRRSHSFWSRLKAPFHR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 77/161 (48%)
rit1NP_001122253.1 P-loop_NTPase 12..180 CDD:304359 79/166 (48%)
small_GTPase 12..177 CDD:197466 79/163 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.