DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and RAP2B

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_002877.2 Gene:RAP2B / 5912 HGNCID:9862 Length:183 Species:Homo sapiens


Alignment Length:175 Identity:82/175 - (46%)
Similarity:125/175 - (71%) Gaps:1/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |.|||:||:|:|||||||||:|.:...|:::|||||||.|||::.:|....:|:||||||.|:::
Human     1 MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 AMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL-ASWNVNNEQ 129
            :|||.|::.|:||:||:::.:.:||:||...|:||.|||..|.|||:|||||.|| ....|:..:
Human    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGE 130

  Fly   130 AREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRG 174
            .:.:|:::..|::|||||.:..||:.|..:||::.......|..|
Human   131 GKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 79/161 (49%)
RAP2BNP_002877.2 Rap2 3..165 CDD:133376 79/161 (49%)
Effector region. /evidence=ECO:0000305 32..40 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.