DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and Rgk3

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster


Alignment Length:190 Identity:53/190 - (27%)
Similarity:92/190 - (48%) Gaps:24/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYD-PTIEDSYRK-QVVIDGETCLLDILDTAGQEEYSA 66
            |::.::|:.||||.||..|...:..::.|| |..:|:.:. .::::|....|..|  .|..|   
  Fly   235 YRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFL--TGNPE--- 294

  Fly    67 MRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQI-KRVKDAEEV---PMVLVGNKCDLA-SWNVN 126
            .:|: :...:.||:|::....:||    |..:|| .|::|.:.:   |.:||.||.||| |..|:
  Fly   295 SKDE-LEQADAFLVVYSCIDKESF----TRAKQILSRLQDMDLLRHRPTILVANKIDLARSRAVS 354

  Fly   127 NEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDN-------KGRRGRKMNK 179
            .:..:.||..:|..:||.|.......|:.....:.:||..||.       |..:.:..||
  Fly   355 AQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 46/166 (28%)
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 48/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453021
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.