DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and rras

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001005931.2 Gene:rras / 449660 ZFINID:ZDB-GENE-041010-217 Length:196 Species:Danio rerio


Alignment Length:168 Identity:100/168 - (59%)
Similarity:126/168 - (75%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68
            |||||||.|||||||||||.||::||.:|||||||||.|...:||:...|||||||||||:.|||
Zfish     7 YKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDILDTAGQEEFGAMR 71

  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWNV-NNEQARE 132
            :||||:|||||||||:|.:.|:.:|..:..||.||||.::.||||||||.||....| :.|:|..
Zfish    72 EQYMRSGEGFLLVFALNDSGSYNEIQKFHTQILRVKDRDDFPMVLVGNKSDLDQQRVISKEEAMT 136

  Fly   133 VAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNK 170
            .|::..|.|:|:|||.|..||:||..:||.|||.::.:
Zfish   137 FARENRIHYMESSAKNRHNVDEAFMEVVRAIRKFQETE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 97/160 (61%)
rrasNP_001005931.2 M_R_Ras_like 5..168 CDD:133345 97/160 (61%)
small_GTPase 19..170 CDD:197466 88/150 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.