DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and ralba

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001003649.1 Gene:ralba / 445255 ZFINID:ZDB-GENE-040801-267 Length:207 Species:Danio rerio


Alignment Length:193 Identity:98/193 - (50%)
Similarity:143/193 - (74%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68
            :|:::||:|||||||||:|.:.:.||::|:||..|||||:||:|||...:|||||||||:|:|:|
Zfish    15 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 79

  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVK-DAEEVPMVLVGNKCDLAS-WNVNNEQAR 131
            |.|.|:||||||||::...:||.....:||||.||| :.:::|::|||||.||.. ..|:.::||
Zfish    80 DNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLLVGNKSDLEDRRQVSVDEAR 144

  Fly   132 EVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDK--DNKGRRGRKMNKPNRR-FK--CKML 189
            ..|:::.:.|:|||||||..||..|:.|:||:|..|  :||.:.|:..||.|:: ||  |.:|
Zfish   145 GKAEEWAVQYVETSAKTRANVDKVFFDLMREVRAKKMSENKDKNGKGKNKKNKKSFKERCCLL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 86/161 (53%)
ralbaNP_001003649.1 RalA_RalB 15..178 CDD:206710 86/162 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.