DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and rap1aa

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001002152.1 Gene:rap1aa / 415242 ZFINID:ZDB-GENE-040625-167 Length:185 Species:Danio rerio


Alignment Length:181 Identity:100/181 - (55%)
Similarity:137/181 - (75%) Gaps:3/181 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |.||||||:|:|||||||||:|.:|..||::|||||||||||||.:||:.|:|:||||||.|:::
Zfish     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWN-VNNEQ 129
            ||||.||:.|:||.||:::.:..:|.|:...||||.||||.|:|||:||||||||.... |..||
Zfish    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEEERVVGKEQ 130

  Fly   130 AREVAKQY-GIPYIETSAKTRMGVDDAFYTLVREI-RKDKDNKGRRGRKMN 178
            .:.:|:|: ...::|:|||:::.|::.||.|||:| ||....|.|..:|.|
Zfish   131 GQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKRAKKKSN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 93/163 (57%)
rap1aaNP_001002152.1 small_GTPase 2..168 CDD:197466 93/165 (56%)
Rap1 3..167 CDD:133375 93/163 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.