DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and rhebl1

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_988937.1 Gene:rhebl1 / 394534 XenbaseID:XB-GENE-493839 Length:184 Species:Xenopus tropicalis


Alignment Length:161 Identity:53/161 - (32%)
Similarity:94/161 - (58%) Gaps:2/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRD 69
            |:|::|...||||:|.:|.|:..|..:|:||||:::.|..|:..:...||::|||||:|||.:..
 Frog     8 KIVMLGYPSVGKSSLALQFIKGDFPKDYEPTIENTWSKTFVMGSDEFELDVVDTAGQDEYSLLPQ 72

  Fly    70 QYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASW--NVNNEQARE 132
            .::....|:::|::|..::||:........:...:....:|:||||||.||.:.  .|..|..::
 Frog    73 SFIFGIHGYIVVYSVACSRSFQIARAIHSILVDRRGKCLMPIVLVGNKNDLPTHCREVKPEDGKK 137

  Fly   133 VAKQYGIPYIETSAKTRMGVDDAFYTLVREI 163
            :|:.:|..::|.|||........|..::.||
 Frog   138 LAESWGAAFLEVSAKDPERSKLIFTKMIEEI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 53/161 (33%)
rhebl1NP_988937.1 RheB 6..184 CDD:206709 53/161 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.