DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and Rras

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001101951.1 Gene:Rras / 361568 RGDID:1311443 Length:218 Species:Rattus norvegicus


Alignment Length:168 Identity:94/168 - (55%)
Similarity:119/168 - (70%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68
            :||||||.|||||||||||.||::||.:|||||||||.|...:||....|||||||||||:.|||
  Rat    30 HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMR 94

  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASW-NVNNEQARE 132
            :||||.|.|||||||:|..:||.::.....||.||||.::.|:||||||.||.:. .|...:|..
  Rat    95 EQYMRAGNGFLLVFAINDRQSFIEVSKLFTQILRVKDRDDFPIVLVGNKADLETQRQVLRSEASS 159

  Fly   133 VAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNK 170
            .:..:.:.|.|.|||.|:.||:||..|||.:||.::.:
  Rat   160 FSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 92/160 (58%)
RrasNP_001101951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 94/168 (56%)
P-loop_NTPase 28..191 CDD:304359 92/160 (58%)
small_GTPase 42..193 CDD:197466 83/150 (55%)
Effector region 58..66 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.