DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and Eras

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_853526.1 Gene:Eras / 353283 MGIID:2665023 Length:227 Species:Mus musculus


Alignment Length:181 Identity:78/181 - (43%)
Similarity:115/181 - (63%) Gaps:12/181 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            :.|||.|||||.||||||||||:....||.::||||:|||.|:|..|....:|::|||:||:.:.
Mouse    39 LPEYKAVVVGASGVGKSALTIQMTHQCFVKDHDPTIQDSYWKEVARDNGGYILNVLDTSGQDIHR 103

  Fly    66 AMRDQYMRTGEGFLLVFAVNSAKSFEDI----GTYREQIKRVKDAEEVPMVLVGNKCDLASWNVN 126
            |:|||.:.:|:|.|.|||::...|.:.:    .|:....|:       |:|||||||||.:...:
Mouse   104 ALRDQCLASGDGVLGVFALDDPSSLDQLQQIWSTWTPHHKQ-------PLVLVGNKCDLVTTAGD 161

  Fly   127 -NEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRK 176
             :..|..:|.:.|.|.::||||||.||::||..||.||::.::......:|
Mouse   162 AHAAAALLAHKLGAPLVKTSAKTRQGVEEAFALLVHEIQRAQEAVAESSKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 76/165 (46%)
ErasNP_853526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
small_GTPase 40..201 CDD:197466 77/167 (46%)
P-loop_NTPase 42..201 CDD:304359 76/165 (46%)
Effector region 70..78 5/7 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.