DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and Rras

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_033127.1 Gene:Rras / 20130 MGIID:98179 Length:218 Species:Mus musculus


Alignment Length:168 Identity:95/168 - (56%)
Similarity:120/168 - (71%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68
            :||||||.|||||||||||.||::||.:|||||||||.|...:||....|||||||||||:.|||
Mouse    30 HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMR 94

  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASW-NVNNEQARE 132
            :||||.|.|||||||:|..:||.::|....||.||||.::.|:||||||.||.:. .|...:|..
Mouse    95 EQYMRAGNGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLENQRQVLRSEASS 159

  Fly   133 VAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNK 170
            .:..:.:.|.|.|||.|:.||:||..|||.:||.::.:
Mouse   160 FSASHHMTYFEASAKLRLNVDEAFEQLVRAVRKYQEQE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 93/160 (58%)
RrasNP_033127.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 95/168 (57%)
M_R_Ras_like 28..191 CDD:133345 93/160 (58%)
Effector region 58..66 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.