DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and Rasd2

DIOPT Version :10

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_598252.1 Gene:Rasd2 / 171099 RGDID:628594 Length:266 Species:Rattus norvegicus


Alignment Length:173 Identity:64/173 - (36%)
Similarity:98/173 - (56%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68
            |::||:||..||||::..:.:...|.|:|.|||||.:||...|.|:...||||||:|...:.|||
  Rat    20 YRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMR 84

  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQI--------KRVKDAEEVPMVLVGNKCDLASWNV 125
            ...:.||:.|:|||:::|.:||:::...::||        .:.|:|.|:|||:.|||      |.
  Rat    85 RLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNK------ND 143

  Fly   126 NNEQARE---------VAKQYGIPYIETSAKTRMGVDDAFYTL 159
            ::|..|:         |:......|.|.|||....|::.||.|
  Rat   144 HSELCRQVPAMEAELLVSGDENCAYFEVSAKKNTNVNEMFYVL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 64/173 (37%)
Rasd2NP_598252.1 Rhes_like 20..266 CDD:133343 64/173 (37%)
Effector region 48..56 6/7 (86%)
Interaction with GNB1, GNB2 and GNB3. /evidence=ECO:0000250 189..235
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.