DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and Ralb

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_446273.1 Gene:Ralb / 116546 RGDID:619852 Length:206 Species:Rattus norvegicus


Alignment Length:192 Identity:100/192 - (52%)
Similarity:141/192 - (73%) Gaps:6/192 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68
            :|:::||:|||||||||:|.:.:.||::|:||..|||||:||:|||...:|||||||||:|:|:|
  Rat    15 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 79

  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVK-DAEEVPMVLVGNKCDLAS-WNVNNEQAR 131
            |.|.|:||||||||::...:||.....:||||.||| :.:::|:::||||.||.. ..|..|:||
  Rat    80 DNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEAR 144

  Fly   132 EVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDK--DNKGRRGRKMNKPNRRFK--CKML 189
            ..|:::|:.|:|||||||..||..|:.|:||||..|  :||.:.|||..|..:.||  |.:|
  Rat   145 GKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKKMSENKDKNGRKSGKSKKSFKERCCLL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 87/161 (54%)
RalbNP_446273.1 RalA_RalB 15..178 CDD:206710 88/162 (54%)
Effector region 43..51 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..206 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.