DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras85D and rras

DIOPT Version :9

Sequence 1:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001107720.1 Gene:rras / 100135709 XenbaseID:XB-GENE-493188 Length:203 Species:Xenopus tropicalis


Alignment Length:164 Identity:102/164 - (62%)
Similarity:124/164 - (75%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67
            :|||||||.|||||||||||.||::||.:|||||||||.|...|||:...|||||||||||:.||
 Frog    13 KYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSIDGKQTRLDILDTAGQEEFGAM 77

  Fly    68 RDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL-ASWNVNNEQAR 131
            |:|||||||||||:||:|...||.::..:..||.||||.:|.||:|||||.|| ....|..|:|.
 Frog    78 REQYMRTGEGFLLIFAINDRGSFNEMSKFHTQILRVKDRDEFPMILVGNKADLDLQRQVTKEEAL 142

  Fly   132 EVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRK 165
            ..|::..|||:|.|||.|:.||::|:.|||.|||
 Frog   143 SFARENHIPYMEASAKIRLNVDESFHELVRAIRK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 99/161 (61%)
rrasNP_001107720.1 M_R_Ras_like 12..175 CDD:133345 99/161 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.