DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEB3 and MAGE

DIOPT Version :9

Sequence 1:NP_001373794.1 Gene:MAGEB3 / 4114 HGNCID:6810 Length:346 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:210 Identity:55/210 - (26%)
Similarity:104/210 - (49%) Gaps:14/210 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   101 SSTVQSRTDPLIMKTNMLVQFLMEMYKMKKPIMKADMLKIV-QKSHKNCFPEILKKASFNMEVV- 163
            |...|...|.:..|...::.::::....|.||...|::.:. .||      |:.|:......:: 
  Fly    16 SQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKS------ELKKRLPLVTNLLA 74

Human   164 --FGVDLKKVDSTKDSYVLVSKMDLPNNGTVTRGRGFPKTGLLLNLLGVIFMKGNCATEEKIWEF 226
              ||:.|..:|:|..:::..::..:.:...:|..:. |:..||..:|..||::||...:.|::..
  Fly    75 ETFGIILTPLDATTKTFICTAEEPVASIHELTPAQR-PQFTLLYIILMYIFLRGNRIEDSKLYVM 138

Human   227 LNKMRIYDGKKHFIFG-EPRKLITQDLVKLKYL--EYRQVPNSNPARYEFLWGPRAHAETSKMKV 288
            |..:.||..::|..|| ..||.|.:..||.:||  |..|:...:.::..|||||||.||.:..::
  Fly   139 LEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQM 203

Human   289 LEFWAKVNKTVPSAF 303
            ::|.:|:....|..|
  Fly   204 VQFASKLLNQHPKVF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEB3NP_001373794.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
MAGE_N 5..93 CDD:403589
MAGE 129..286 CDD:396164 47/163 (29%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 47/171 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151973
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.