DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlb1 and Srfbp1

DIOPT Version :9

Sequence 1:NP_477099.1 Gene:Rlb1 / 41139 FlyBaseID:FBgn0014022 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001005536.1 Gene:Srfbp1 / 291469 RGDID:1359398 Length:442 Species:Rattus norvegicus


Alignment Length:475 Identity:113/475 - (23%)
Similarity:190/475 - (40%) Gaps:118/475 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKFNNLVISNKKVIQKARAQTIAKIVQKLRKTK------EALAKNPDSEKEKIRLRKNTECLAQL 62
            |..||.|:..:|.:::.|...|.|:|:.:.:.|      :||.||   ::...||.:....:.:|
  Rat    17 LNLNNEVVKMRKEVKRIRVLVIRKLVRSVSRLKSKKGSEDALLKN---QRRAQRLLQEIHAMKEL 78

  Fly    63 KALKYMDMVRQSLLQEGTNPNAVIANERSTPDELGIAMLRLNKLMHGLVDKFVETLKLS-TTDKE 126
            |.    |::.:|.|.:..|.........||..|..||.|    .:|.|:.:.|:.||.: ...|:
  Rat    79 KP----DVITKSALNDDINFEKTCKKPDSTATERAIARL----AVHPLLKRKVDALKAAIQAFKD 135

  Fly   127 AKWREEILETSKR-----------RAKIERTEERKRKRKELKEQKAQ-------------TKNRL 167
            |:......|:||.           |::.|.:|.:..:|..:.|||.:             :|.:|
  Rat   136 ARQNAPEAESSKSASKESQCEDIPRSQAEASESQHPERTVVGEQKGKDKDPTTAKKAGSGSKEKL 200

  Fly   168 EWLEQN-KVV------------DADVNGATAETPTLQVSKVNDQEIPQSFAKTENSPVLKVKKEK 219
            ...:|. |.|            .|.:|......||    ..|..:...|...||:|..     |.
  Rat   201 AKGKQGPKAVATPHSPGKPSEKGAGINSERQGAPT----PGNHSQGKASTRTTEDSVC-----EP 256

  Fly   220 TPKTPAKKERNLQKKQAFDEQINPEITKLSSKKQNLNTIKENNAEPQLEGRPKESKPKPFE-KKP 283
            ...:.:|:|.:.::|:.||:.......|.||..::     .::.:....|:.:.::.|... ...
  Rat   257 DDNSISKEEVSEEEKEYFDDSTEERFYKQSSASED-----SDSGDDFFIGKVRRTRKKECAVPSS 316

  Fly   284 AREQKPKPRLERQPSIDEEEPQLDNNRPTHVVDP--------FFITESGQPYLSSAVVLSGDNDS 340
            |:||||.|::..:.:..|....:.|::  |.:.|        ||.:            |||...|
  Rat   317 AKEQKPLPKVSSKTNTLETHWDIRNDK--HKLIPEARKLESVFFHS------------LSGPKSS 367

  Fly   341 EAD-EEQAP-----------PPVK-RFRNEDRRSNTYREKPERQPEFKARKPTDDRHPSWLA--- 389
            ..| .||||           ||:: :|....||.....::|...|          .||||.|   
  Rat   368 RRDPREQAPKNKAPDIPENEPPIQNKFTKSARRGFESAKQPSYAP----------LHPSWEASRR 422

  Fly   390 KQQQKPIIGDFRGKKITFGD 409
            :::|:..|..|:||||||.|
  Rat   423 RKEQQSKIAVFQGKKITFDD 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rlb1NP_477099.1 PTZ00108 <3..345 CDD:240271 87/394 (22%)
BUD22 <389..461 CDD:286199 11/24 (46%)
Srfbp1NP_001005536.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..336 42/212 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..442 31/105 (30%)
BUD22 <412..441 CDD:286199 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1397283at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23325
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.070

Return to query results.
Submit another query.