DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlb1 and SPAC4F10.06

DIOPT Version :9

Sequence 1:NP_477099.1 Gene:Rlb1 / 41139 FlyBaseID:FBgn0014022 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_594749.1 Gene:SPAC4F10.06 / 2543574 PomBaseID:SPAC4F10.06 Length:388 Species:Schizosaccharomyces pombe


Alignment Length:405 Identity:85/405 - (20%)
Similarity:151/405 - (37%) Gaps:95/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KLSTTDKEAK---WREEILETSKRRAKIERTEERKRKRKELKEQKAQTKNRLE-------WLEQN 173
            :||..|...|   ::::|.:..|:.:..||.:..:|.:.....:.|.|..|.|       ..:..
pombe    17 QLSVDDVPKKIPLFKKKISQALKKASTFERQKLVRRIKNCRASEDADTLGRFEAEFEFAKQFDFT 81

  Fly   174 KVVDADVNGATAETPTLQVSKVNDQEIPQSFAK--TENSPVLKVKKEKTPKTPAKKERN----LQ 232
            |.||........:....:  |:.::.:...|..  ||::....|.:....|..:...||    |:
pombe    82 KFVDYCYYKKILKNKDFR--KLLNENLHVDFPADLTEDAQRNTVARILNSKQLSDAIRNINSILE 144

  Fly   233 KKQAFDEQINPEITKLSSKK----------------------QNLNTIKENNAEPQLEGRPKE-- 273
            |...|   :||::.:||.||                      .|.:.:...:.:...:|..::  
pombe   145 KYLRF---LNPDLQELSDKKAVSSTQKPIKTIGKVDLSNKSTSNQDQVDNTHVQNSTDGVNQDTG 206

  Fly   274 -----SKPKPFEKKPAREQKPK----------PRLERQPSIDEE--EPQLDNNRPTHVVDPFFIT 321
                 ::.|...|..:...|.:          ..:.|:..||:|  |..|..:..|::       
pombe   207 MILDNTEDKEINKSMSYSMKNEGVKESSLQNATLINRKSIIDDEMLEIPLGKHNNTNL------- 264

  Fly   322 ESGQPYLSSAVVLSGDNDSEADEEQAP----PPVKRFRNEDRRSNTYREKPERQPEFKARKPTDD 382
                |.|::..:...::|.|..|::..    |..|..|.:..|...:.:|..:......:|.|::
pombe   265 ----PALTAGFLDPVESDDEFVEKELEEVDIPKRKNRRGQRARQAIWEKKYGKGANHLIKKATEE 325

  Fly   383 RHPSWLAKQQQKPIIGDFRGKKITFGDDGQAAEIIAPSINQLTATAAPLPTDGMHPSWVAKQKFK 447
            |.            |.:.|.:|.   ::.||..  |...|..|....|...:.:||||.||:|.|
pombe   326 RS------------IREERQRKY---EERQAKR--AARENAFTEHQTPQKPEQLHPSWEAKRKQK 373

  Fly   448 -PKIAAFQGTKIKFD 461
             |..|||||.||.||
pombe   374 MPSSAAFQGKKIVFD 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rlb1NP_477099.1 PTZ00108 <3..345 CDD:240271 49/282 (17%)
BUD22 <389..461 CDD:286199 25/72 (35%)
SPAC4F10.06NP_594749.1 BUD22 32..388 CDD:286199 79/388 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23325
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.