DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlb1 and SRFBP1

DIOPT Version :9

Sequence 1:NP_477099.1 Gene:Rlb1 / 41139 FlyBaseID:FBgn0014022 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_689759.2 Gene:SRFBP1 / 153443 HGNCID:26333 Length:429 Species:Homo sapiens


Alignment Length:456 Identity:105/456 - (23%)
Similarity:189/456 - (41%) Gaps:83/456 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKFNNLVISNKKVIQKARAQTIAKIVQKL------RKTKEALAKNPDSEKEKIRLRKNTECLAQL 62
            |..||.|:..:|.:::.|...|.|:|:.:      :.|::||.||   ::...||.:....:.:|
Human     7 LNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTEDALLKN---QRRAQRLLEEIHAMKEL 68

  Fly    63 KALKYMDMVRQSLLQEGTNPNAVIANERSTPDELGIAMLRLNKLMHGLVDKFVETLKLST-TDKE 126
            |.    |:|.:|.|.:..|...:.....||..|..||.|    .:|.|:.|.::.||.:. ..||
Human    69 KP----DIVTKSALGDDINFEKIFKKPDSTATERAIARL----AVHPLLKKKIDVLKAAVQAFKE 125

  Fly   127 AKWREEILETSKRRAKIERTEER----------KRKRKELKEQKA-QTKNRLEWLEQNKVVDADV 180
            |:.....:|:||..::...:|..          :|:...:.|||. :||    .|.:..:.::..
Human   126 ARQNVAEVESSKNASEDNHSENTLYSNDNGSNLQREATVISEQKVKETK----ILAKKPIHNSKE 186

  Fly   181 NGATAETPTLQVSKVNDQEIPQSFAKTENSPVLKVKKEKTPKTP-------AKKERNL------- 231
            ..|..|.....|:..|....|     :|...|:.::.:|||..|       .||.:..       
Human   187 KIAKMEHGPKAVTIANSPSKP-----SEKDSVVSLESQKTPADPKLKTLSQTKKNKGSDSSLSGN 246

  Fly   232 ---------QKKQAFDEQINPEITKLSSKKQNLNTIKENNAEPQLEGRPKESKPKPFE-KKPARE 286
                     ::|:.||:.......|.||..::     .::.:....|:.:.::.|... ....:|
Human   247 SDGGEEFCEEEKEYFDDSTEERFYKQSSMSED-----SDSGDDFFIGKVRRTRKKESSCHSSVKE 306

  Fly   287 QKPKPRLERQPSIDEEEPQLDNNRPTHVVDPFFITESGQPYLSSAVV--LSGDNDSEADEEQAPP 349
            |||..::..:....|......|::    :.|  .||:.:  |.|...  |||...|..:.::..|
Human   307 QKPLEKVFLKEDTGETHGDTRNDK----IKP--STETRK--LESVFFHSLSGSKSSRRNFKEQAP 363

  Fly   350 PVKRF---RNEDRRSNTYREKPERQPEFKARKPTDDRHPSWLA---KQQQKPIIGDFRGKKITFG 408
            ..:..   :||.:..|.:.:|...:.|...::.....||||.|   :::|:..|..|:||||||.
Human   364 KTRSLDFPQNEPQIKNQFNKKLSGRLENTKQQLQLPLHPSWEASRRRKEQQSNIAVFQGKKITFD 428

  Fly   409 D 409
            |
Human   429 D 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rlb1NP_477099.1 PTZ00108 <3..345 CDD:240271 84/384 (22%)
BUD22 <389..461 CDD:286199 11/24 (46%)
SRFBP1NP_689759.2 TOP2c <37..285 CDD:330395 58/272 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..157 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..429 57/270 (21%)
BUD22 <399..428 CDD:312565 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1397283at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23325
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
33.070

Return to query results.
Submit another query.