DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and SART3

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_005269298.1 Gene:SART3 / 9733 HGNCID:16860 Length:981 Species:Homo sapiens


Alignment Length:373 Identity:74/373 - (19%)
Similarity:135/373 - (36%) Gaps:126/373 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DRSRERRNCRVYISNIPYDYRWQD--LKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENV 111
            |.|::  :..|::||:||..:..|  |:.|| ...|.:..::..|...|..||...||||:.::.
Human   716 DSSKD--SITVFVSNLPYSMQEPDTKLRPLF-EACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSA 777

  Fly   112 QKALEKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDH 176
            .:||| |:|..|.||.:.|..                                            
Human   778 LQALE-MDRKSVEGRPMFVSP-------------------------------------------- 797

  Fly   177 MDDRDRGFSRRDDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVANLDY 241
                                     ..|.:.:.::.::..|.| ||.        :|:|::.|.:
Human   798 -------------------------CVDKSKNPDFKVFRYSTS-LEK--------HKLFISGLPF 828

  Fly   242 KVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRL 306
            ....::|:::.|..|.|:.:.|..::.|..:|.|.:||::..:|.||:..:|...:.:..:.|.:
Human   829 SCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAI 893

  Fly   307 D-----RIPDKNEGIKLPEGLGGVGIGLGPNGEPLRDVAHNLPNGGQSQGQLLGNAQQGSQLGSV 366
            .     ::|:|.|..|            .|.|..|....:.....|::|..||..|.|       
Human   894 SNPPQRKVPEKPETRK------------APGGPMLLPQTYGARGKGRTQLSLLPRALQ------- 939

  Fly   367 GSQPNSSAVSNATTNLLNNLTGVMFGNHAAVQPSPVAP--VQKPSLGN 412
              :|:::|....              |..|..|:..||  .:.|.:.|
Human   940 --RPSAAAPQAE--------------NGPAAAPAVAAPAATEAPKMSN 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 74/373 (20%)
RRM1_hnRNPM_like 58..133 CDD:240831 27/76 (36%)
RRM2_hnRNPM_like 234..307 CDD:240832 17/72 (24%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
SART3XP_005269298.1 RNA14 100..>478 CDD:227438
NRDE-2 351..>504 CDD:285605
RRM 654..876 CDD:223796 49/241 (20%)
RRM1_SART3 723..796 CDD:240837 26/74 (35%)
RRM2_SART3 817..897 CDD:240838 19/87 (22%)
LSM_int_assoc 895..951 CDD:293211 15/90 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.