DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and SNP1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:177 Identity:44/177 - (24%)
Similarity:76/177 - (42%) Gaps:49/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDE-SGKARGCGIVEFKDPENVQKALEKMNRY- 121
            ::|..:|||....:|:..|.:. |.||.:::..|: :.|::|...:.||||.:.:.|.:::..: 
Yeast   109 IFIGRLPYDLDEIELQKYFVKF-GEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHR 172

  Fly   122 --EVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGF 184
              ::..|..:|..:.| :..:|.:..|.|||.||                            ||:
Yeast   173 GIQIKDRICIVDIERG-RTVKYFKPRRLGGGLGG----------------------------RGY 208

  Fly   185 SRRDDDRLSGR----NNFNMMSNDY--------NNSSNYNL--YGLS 217
            |.| |.||.||    :..|....:|        .:||.|:.  ||.|
Yeast   209 SNR-DSRLPGRFASASTSNPAERNYAPRLPRRETSSSAYSADRYGSS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 44/177 (25%)
RRM1_hnRNPM_like 58..133 CDD:240831 19/77 (25%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
SNP1NP_012203.1 U1snRNP70_N 6..95 CDD:403437
RRM_SNP1_like 89..201 CDD:410194 22/93 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.