DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and NOP6

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_010068.1 Gene:NOP6 / 851313 SGDID:S000002372 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:40/211 - (18%)
Similarity:73/211 - (34%) Gaps:76/211 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASNSVES--REKERDRRGRGARGSRFTDADGNGNGAGSQGGGVAARDRSRERRNCRVYISNIPYD 67
            |.|..|.  ::|.:.|||||.:|..           |.:|....            |::.::|.|
Yeast    47 AGNDGEEPVKKKRKTRRGRGGKGKN-----------GKKGNRFI------------VFVGSLPRD 88

  Fly    68 YRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEF---KDPENVQKALEKMNRYEVNGRELV 129
            ....:|::.|:.  .|.:.::|..|     :|...:||   ||...:|:.::            :
Yeast    89 ITAVELQNHFKN--SSPDQIRLRAD-----KGIAFLEFDADKDRTGIQRRMD------------I 134

  Fly   130 VKEDHG----EQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRRDDD 190
            ....||    |::......|                      ||||..::.::.......:.|::
Yeast   135 ALLQHGTLLKEKKINVELTV----------------------GGGGNSQERLEKLKNKNIKLDEE 177

  Fly   191 RLSGRNNFNMMSNDYN 206
            |   :.....|.||.|
Yeast   178 R---KERLTKMINDGN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 28/166 (17%)
RRM1_hnRNPM_like 58..133 CDD:240831 14/77 (18%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
NOP6NP_010068.1 NARP1 <1..55 CDD:403685 3/7 (43%)
RRM_Nop6 78..151 CDD:409834 17/103 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.