DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and AT1G45100

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_175125.1 Gene:AT1G45100 / 841077 AraportID:AT1G45100 Length:497 Species:Arabidopsis thaliana


Alignment Length:249 Identity:48/249 - (19%)
Similarity:88/249 - (35%) Gaps:82/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRY-- 121
            ::::|:....:..|:.:.|:. ||.:.:|:|..:..||..|.|.|||......:|||.|...|  
plant   249 LFVANLRDSIQISDIINFFKD-VGEVVHVRLIVNSQGKHAGWGFVEFASANEAEKALVKNGEYLH 312

  Fly   122 ----EVNGRELVVKE------DHGEQRDQYGR----IVRDGGGGGGGGGGVQGGNGGNNGGGGGG 172
                .::|.:.....      ||....:.|.|    ::::          |:|..|         
plant   313 NYKISLDGAKTAPHRPPKFCLDHKVWYEDYLRRESLLIKE----------VEGVEG--------- 358

  Fly   173 GRDHMDDRDRGFSRRDDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVA 237
                :|:                                     :..|||.:...   .|.||||
plant   359 ----LDE-------------------------------------TPDFLEEVAAR---KNTVFVA 379

  Fly   238 NLDY--KVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAI 289
            ||.|  ::....:...|...|::..:.:.:|..|...|...:|::...||.:|:
plant   380 NLPYNCRLIVPTIINFFSDVGEIVHIRIIVDHMGEPVGCGFVEFNSSNEAEKAL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 48/249 (19%)
RRM1_hnRNPM_like 58..133 CDD:240831 20/85 (24%)
RRM2_hnRNPM_like 234..307 CDD:240832 16/58 (28%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
AT1G45100NP_175125.1 RRM_SF 65..>95 CDD:302621
RRM_SF 160..228 CDD:240668
RRM_SF 248..322 CDD:302621 20/73 (27%)
RRM_SF 376..439 CDD:240668 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174365at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.