DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and AT5G41690

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001332758.1 Gene:AT5G41690 / 834172 AraportID:AT5G41690 Length:567 Species:Arabidopsis thaliana


Alignment Length:338 Identity:63/338 - (18%)
Similarity:118/338 - (34%) Gaps:101/338 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMN 119
            |...::::|:||:.:..::.|.|:: ||.:..|||..:..||..|||.|||......::||:|.|
plant    66 REKTLFVANLPYETKIPNIIDFFKK-VGEVVRVQLIVNLKGKLVGCGFVEFASVNEAEEALQKKN 129

  Fly   120 RYEVNGRELVVK---------------------------EDHGEQRDQ----------------- 140
            ...::..::.:.                           |.|..:.|:                 
plant   130 GECLDNNKIFLDVANKKATYLPPKYCIDHKVWDKDYRRLESHPIEEDERPPNSVEEVLFVANLSP 194

  Fly   141 -------------YGRIVR-----DGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRR 187
                         .|.:|.     :..|...|.|.|:..:.              |:..:....:
plant   195 QTKISDIFDFFNCVGEVVSIRLMVNHEGKHVGYGFVEFASA--------------DETKKALENK 245

  Fly   188 DDDRLSGRNNFNMMSN--DYNNSSNYNLY-------------------GLSASFLESLGISGPLH 231
            :.:.|.....|..::.  .|.....|||.                   .....|:|::|:.   .
plant   246 NGEYLHDHKIFIDVAKTAPYPPGPKYNLVEKLCYEDYLRRESLPIDEDETPPEFVEAVGVR---K 307

  Fly   232 NKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQM 296
            ..:|||:|..|.:...:...||..|:|..|.|.|:..|...|.|.:|:....||..|:...:.:.
plant   308 KTLFVAHLSRKTEITHIINFFKDVGEVVHVRLILNHTGKHVGCAFVEFGSANEAKMALETKNGEY 372

  Fly   297 LFDRRMTVRLDRI 309
            |.|.::.:.:.::
plant   373 LNDCKIFLEVAKM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 63/338 (19%)
RRM1_hnRNPM_like 58..133 CDD:240831 22/101 (22%)
RRM2_hnRNPM_like 234..307 CDD:240832 21/72 (29%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
AT5G41690NP_001332758.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174365at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.