DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and RSZ22

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_194886.1 Gene:RSZ22 / 829285 AraportID:AT4G31580 Length:200 Species:Arabidopsis thaliana


Alignment Length:164 Identity:43/164 - (26%)
Similarity:69/164 - (42%) Gaps:35/164 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYE 122
            |||:.|:......::|:|.||.. |.:..|.:    :.:..|...::|:||.:.:.|:..::  .
plant     3 RVYVGNLDPRVTERELEDEFRAF-GVVRSVWV----ARRPPGYAFLDFEDPRDARDAIRALD--G 60

  Fly   123 VNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGG--------GGRDHM-- 177
            .||..:....:.||:             ||||.||.:||.||..||.||        |...|.  
plant    61 KNGWRVEQSHNRGER-------------GGGGRGGDRGGGGGGRGGRGGSDLKCYECGETGHFAR 112

  Fly   178 DDRDRGFSRRDDDRLSGRNNFNMMSNDYNNSSNY 211
            :.|:||.:.|...:...|.     ...|..|.:|
plant   113 ECRNRGGTGRRRSKSRSRT-----PPRYRRSPSY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 43/164 (26%)
RRM1_hnRNPM_like 58..133 CDD:409819 17/74 (23%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
RSZ22NP_194886.1 RRM_SRSF3_like 3..71 CDD:409808 17/74 (23%)
zf-CCHC 100..114 CDD:395050 2/13 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.