DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and AT4G09040

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_192643.2 Gene:AT4G09040 / 826483 AraportID:AT4G09040 Length:304 Species:Arabidopsis thaliana


Alignment Length:299 Identity:52/299 - (17%)
Similarity:98/299 - (32%) Gaps:100/299 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYE 122
            |:...|:|:....:|::.||.: .||:..:::...:..:.||...:|...||....||:.:...|
plant    95 RLIAQNVPWTSTPEDIRSLFEK-YGSVIDIEMSMHKKERNRGLVFIEMASPEEAATALKSLESCE 158

  Fly   123 VNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRR 187
            ..||.|  |.|:.:.:                                         :.:.::.|
plant   159 YEGRRL--KVDYAKTK-----------------------------------------KKKTYAPR 180

  Fly   188 DDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVF 252
            :..  |....||:                                  |||||.::...|.||:.|
plant   181 ETP--SPVPTFNL----------------------------------FVANLAFEARAKHLKEFF 209

  Fly   253 KL-AGKVQSVDLSL-DKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEG 315
            .. .|.|.|.::.. :....|.|:..:.:....:|..|:.....:....|.:     |:....:.
plant   210 DADTGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAALIEFQGKDFLGRPI-----RLAKSKQF 269

  Fly   316 IKL--PEGLGGVGIGLGPNGEPLRDVAHNLPNGGQSQGQ 352
            :||  .|||           :|..:.|...|:..::..|
plant   270 VKLQAKEGL-----------QPPEEEAEEEPSQSETMTQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 52/299 (17%)
RRM1_hnRNPM_like 58..133 CDD:240831 20/74 (27%)
RRM2_hnRNPM_like 234..307 CDD:240832 17/74 (23%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
AT4G09040NP_192643.2 RRM_SF 100..167 CDD:409669 19/69 (28%)
RRM 190..263 CDD:214636 18/111 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23003
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.