DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and AT3G48840

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_190453.4 Gene:AT3G48840 / 824045 AraportID:AT3G48840 Length:189 Species:Arabidopsis thaliana


Alignment Length:87 Identity:29/87 - (33%)
Similarity:43/87 - (49%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAARDRSRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPE 109
            ||.|.::       ::|:|:|.......:.:.||. ||.:..|:|..|..||..|||.|||....
plant    35 VAVRKKT-------LFIANLPLKSEMPHIINFFRD-VGEVVSVRLIVDHRGKHVGCGFVEFASAY 91

  Fly   110 NVQKA-LEKMNRYEVNGRELVV 130
            ..:|| |||.|...:..|.:|:
plant    92 KAKKAPLEKKNLRRLRNRYVVL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 27/84 (32%)
RRM1_hnRNPM_like 58..133 CDD:240831 26/74 (35%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
AT3G48840NP_190453.4 RRM <2..>150 CDD:223796 29/87 (33%)
RRM_SF 41..117 CDD:302621 26/81 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174365at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.