DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and AT3G10845

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_683549.1 Gene:AT3G10845 / 820254 AraportID:AT3G10845 Length:423 Species:Arabidopsis thaliana


Alignment Length:266 Identity:54/266 - (20%)
Similarity:103/266 - (38%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEV 123
            ::::|:....:..|:.. |.:.||.:..|:|..:...|..||..|||......:|.||..|....
plant   129 LFVANLSPQTKILDIFG-FCQDVGEVVSVRLIANHEDKPVGCAFVEFLSANEAKKVLENKNGEYF 192

  Fly   124 NGRELVVKEDHGEQRD-QYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRR 187
            :|.::::...|||..| ...|::.:..|...|.|.|:..:.              .:.:....::
plant   193 HGHKIILMRGHGETPDFAEHRLIVNHTGKHVGKGFVEFASA--------------KEAENALEKK 243

  Fly   188 DDDRLSGRNNFNMMSN----------DY--NNSSNYNLYGLSAS--FLESLGISGPLHNKVFVAN 238
            ..:.|.....|...:|          ||  .......:.||:.:  |:|.     .....:||.|
plant   244 KGEYLQDGEIFLKAANIAPFPPPKYEDYLGQERDEAAVEGLAETPYFVEE-----ARKKTLFVTN 303

  Fly   239 LDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLFDRRMT 303
            |..:...:::...|: ..:|..|.|.:|:.|...|....|:....||.:|:...:.:.|...::.
plant   304 LPPRTSIQRMLYFFQ-DFEVVRVRLIVDQSGKHMGCGYFEFASANEAEKALEQRNGKSLRYHKIF 367

  Fly   304 VRLDRI 309
            :.|..|
plant   368 LELAEI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 54/266 (20%)
RRM1_hnRNPM_like 58..133 CDD:240831 18/73 (25%)
RRM2_hnRNPM_like 234..307 CDD:240832 16/72 (22%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
AT3G10845NP_683549.1 RRM_SF 129..197 CDD:240668 18/68 (26%)
RRM_SF <213..248 CDD:302621 5/48 (10%)
RRM_SF 299..369 CDD:240668 16/70 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174365at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.