DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and AT2G35410

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:298 Identity:54/298 - (18%)
Similarity:105/298 - (35%) Gaps:113/298 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DRSRERRNC----RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPE 109
            :::.|.:|.    ::::.|:|:.....|:.:||.: .|::..|::...:.||.||...|.....|
plant    83 EKTEETQNSNLKRKLFVFNLPWSMSVNDISELFGQ-CGTVNNVEIIRQKDGKNRGFAFVTMASGE 146

  Fly   110 NVQKALEKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGR 174
            ..|.|::|.:.::|:||.:.|                                            
plant   147 EAQAAIDKFDTFQVSGRIISV-------------------------------------------- 167

  Fly   175 DHMDDRDRGFSRRDDDRLSGRNNFNMMS----NDYNNSSNYNLYGLSASFLESLGISGPLHNKVF 235
                    .|:||          |...:    ||..:.:                 .|...:|::
plant   168 --------SFARR----------FKKPTPKSPNDLPSPA-----------------PGDTRHKLY 197

  Fly   236 VANLDYKVDNKKLKQVFKLA--GKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLF 298
            |:||.:|..:..|:::|..|  ..|.:..:..|.||.|.|:..:.:....||..||:.|:.:.:.
plant   198 VSNLAWKARSTHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATREEAENAITKLNGKEIM 262

  Fly   299 DRRMTVRL-----------------------DRIPDKN 313
            .|.:|::.                       |.:.|||
plant   263 GRPITLKFSLRSASESEDGDSVEANNASEDGDTVEDKN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 54/298 (18%)
RRM1_hnRNPM_like 58..133 CDD:240831 20/74 (27%)
RRM2_hnRNPM_like 234..307 CDD:240832 20/97 (21%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 48/261 (18%)
RRM_SF 97..168 CDD:409669 20/123 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.