DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and AT2G27330

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_565646.2 Gene:AT2G27330 / 817276 AraportID:AT2G27330 Length:116 Species:Arabidopsis thaliana


Alignment Length:113 Identity:30/113 - (26%)
Similarity:47/113 - (41%) Gaps:5/113 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 LYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDK-EGNSRGFAV 276
            ||......|.|...|..|    ||..:.:....:.|.|.|...|:|..||:.:|| ....:|||.
plant     6 LYRSFTPLLFSRSFSSTL----FVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAY 66

  Fly   277 IEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEGIKLPEGLGG 324
            :.:....||.:|:..|:.|::..|.:.:...:....|.....|...||
plant    67 VTFSSKEEAEKALLELNAQLVDGRVVILDTTKAAKHNPPDTKPNHAGG 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 30/113 (27%)
RRM1_hnRNPM_like 58..133 CDD:409819
RRM2_hnRNPM_like 234..307 CDD:409820 20/73 (27%)
RRM_SF 565..629 CDD:473069
AT2G27330NP_565646.2 RRM_SF 23..99 CDD:473069 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.