DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and RSZ22a

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_180035.1 Gene:RSZ22a / 816995 AraportID:AT2G24590 Length:196 Species:Arabidopsis thaliana


Alignment Length:166 Identity:44/166 - (26%)
Similarity:66/166 - (39%) Gaps:46/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYE 122
            |||:.|:......::|:|.||.. |.|..|.:    :.:..|...::|:|..:.:.|:.     |
plant     3 RVYVGNLDPRVTERELEDEFRSF-GVIRSVWV----ARRPPGYAFLDFEDSRDARDAIR-----E 57

  Fly   123 VNGRE-LVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGG------------------ 168
            |:|:. ..|::.|..            |||||.|||..||:||...|                  
plant    58 VDGKNGWRVEQSHNR------------GGGGGRGGGRGGGDGGRGRGGSDLKCYECGESGHFARE 110

  Fly   169 ----GGGGGRDHMDDRDRGFSR-RDDDRLSGRNNFN 199
                ||.|||.....|.|...| |......||.:::
plant   111 CRSRGGSGGRRRSRSRSRSPPRYRKSPTYGGRRSYS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 44/166 (27%)
RRM1_hnRNPM_like 58..133 CDD:409819 19/75 (25%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
RSZ22aNP_180035.1 RRM_SRSF3_like 3..71 CDD:409808 19/77 (25%)
zf-CCHC 97..111 CDD:395050 0/13 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.