DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and tia1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_997793.1 Gene:tia1 / 793165 ZFINID:ZDB-GENE-030131-1506 Length:386 Species:Danio rerio


Alignment Length:411 Identity:80/411 - (19%)
Similarity:138/411 - (33%) Gaps:111/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEV 123
            :|:.|:..|.....:..||.:| |..:..::..|.:|....| .|||.:..:...:|..||..::
Zfish    10 LYVGNLSRDVTEALIMQLFGQI-GPCKSCKMIVDTAGNDPYC-FVEFFEHRHAAASLAAMNGRKI 72

  Fly   124 NGRELVV---------KEDHGEQ-------------------------RDQYGRIVRDGGGGGGG 154
            .|:|:.|         |:|....                         |....|:|:|...|...
Zfish    73 MGKEVKVNWATSPSSQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSK 137

  Fly   155 GGG-------------VQGGNGGNNGGGGGGGRDHMDDRDRGFSRRDDDRLSGRNNFNMMSNDYN 206
            |.|             :|     ..||...|||   ..|....:|:..                .
Zfish   138 GYGFVSFFNKWDAENAIQ-----QMGGQWLGGR---QIRTNWATRKPP----------------A 178

  Fly   207 NSSNYNLYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNS 271
            ..:.|.......||.|.:..|.|.:..|:...:...:..:.::|.|...|::..|.:..||    
Zfish   179 PKATYETNTKHLSFDEVVNQSSPSNCTVYCGGVTTGLTEQLMRQTFSPFGQIMEVRVFPDK---- 239

  Fly   272 RGFAVIEYDHPVEAVQAISMLDRQML--------FDRRMTVRLDRIPDKNEGIKLPEGLGGVGIG 328
             |::.:.::....|..||..::...|        :.:..|   |.:....: :::|: ...||..
Zfish   240 -GYSFVRFNSHESAAHAIVSVNGTSLEGHIVKCYWGKETT---DMVSPMQQ-VQVPQ-QSKVGFA 298

  Fly   329 LGPNGE------PLRDVAHNLPNG---------GQSQGQL-LGNAQQGSQLGSVGSQPNSSAVSN 377
            ..|.|:      ..:.::..:|||         ||:..|. ..:.|.|:....||:..|...|..
Zfish   299 AQPYGQWGQWYGNAQQISQYVPNGWQVPTYGVYGQAWNQQGFNHLQAGAGWAGVGAVSNGGVVEP 363

  Fly   378 AT----TNLLNNLTGVMFGNH 394
            |.    |.|.|..|....|.|
Zfish   364 AQGVNGTVLANQSTMGTAGYH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 80/411 (19%)
RRM1_hnRNPM_like 58..133 CDD:240831 20/82 (24%)
RRM2_hnRNPM_like 234..307 CDD:240832 13/80 (16%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
tia1NP_997793.1 ELAV_HUD_SF 6..270 CDD:273741 54/290 (19%)
RRM1_TIA1 9..82 CDD:241059 19/73 (26%)
RRM2_TIA1 95..174 CDD:241062 14/86 (16%)
RRM3_TIA1 204..277 CDD:241065 12/77 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.