DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Snrnp35

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_083808.1 Gene:Snrnp35 / 76167 MGIID:1923417 Length:244 Species:Mus musculus


Alignment Length:142 Identity:40/142 - (28%)
Similarity:65/142 - (45%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 ASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLD-KEGNSRGFAVIEYDH 281
            |.::.:.|::|.....:|||.|:.:...:|||:||...|.::.:.|..| ..|.|:|:|.|||..
Mouse    37 ARYVPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKE 101

  Fly   282 PVEAVQAIS-----MLDRQMLFDRRMTVRLDR-----IPDKNEGIKLPEGLGGV----GIGLGPN 332
            ....::|..     ::|:..:|   :...|:|     ||.:..|     ||||.    .:..|..
Mouse   102 ERALMKAYRDADGLVIDQHEIF---VDYELERTLRGWIPRRLGG-----GLGGKKESGQLRFGGR 158

  Fly   333 GEPLRDVAHNLP 344
            ..|.|... |||
Mouse   159 DRPFRKPI-NLP 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 40/142 (28%)
RRM1_hnRNPM_like 58..133 CDD:240831
RRM2_hnRNPM_like 234..307 CDD:240832 22/78 (28%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
Snrnp35NP_083808.1 RRM_snRNP35 48..137 CDD:240683 24/91 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..244 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.